Patent Information


DRAVP ID  DRAVPa0245

Peptide Name   Sequence 66 from Patent US 7811577 B2

Sequence  NHTFEVENSTLNGMDLIERQIKILYAMILQTHADVQ

Sequence Length  36

Source  Synthetic construct

Target Organism  HIV

Patent Type  Granted Patent

Publication Date  2010-12-12

Patent No  US 7811577 B2

Family Info  WO 2005/118886 A2, AU 2005/250430 A1, CA 2567030 A1, WO 2005/118886 A3, EP 1755667 A2, CN 1968710 A, US 2007/0224212 A1, JP 2008501028 A, EP 1755667 A4, US 7811577 B2, EP 2354153 A2, AU 2005/250430 B2

Patent Title  Covalently stabilized chimeric coiled-coil HIV gp41 N-peptides with improved antiviral activity

Comment  No comments found in patent

Abstract  Methods of covalently-stabilizing alpha-helical, chimeric peptides constrained within a homotrimeric or heterotrimeric coiled-coil structure are disclosed. The coiled-coil structures made by the methods disclosed within this specification mimic all or a portion of the internal, trimeric coiled-coil motif contained within the fusogenic conformation of an enveloped virus membrane-fusion protein, particularly the internal coiled-coil domain of the HIV gp41 ectodomain. The HIV-derived, chimeric peptides disclosed comprise a non-HIV, soluble, trimeric form of a coiled-coil fused in helical phase to all or a portion of the N-helix of HIV gp41 and are covalently-stabilized in a homotrimeric or heterotrimeric coiled-coil structure through the formation of disulfide or chemoselective bonds between said peptides. The covalently-stabilized, HIV-derived, homotrimeric or heterotrimeric coiled-coil structures made by the methods disclosed herein represent a close mimetic of a HIV gp41 fusion intermediate and are potent inhibitors of HIV infectivity. These HIV-derived chimeric peptides may provide for therapeutic treatment against HIV infection by inhibiting the virus-host cell membrane fusion process.