Patent Information


DRAVP ID  DRAVPa0538

Peptide Name   Sequence 213 from Patent US 7582301 B1

Sequence  LEANISQSLEQAQIQQEKNMYELQKLNSWDVFT

Sequence Length  33

Source  Synthetic construct

Target Organism  HIV

Patent Type  Granted Patent

Publication Date  2009-09-01

Patent No  US 7582301 B1

Family Info  CA 2372338 A1, WO 2000/069902 A1, AU 2000/050271 A, EP 1179012 A1, BR 0010757 A, CN 1351611 A, EP 1179012 B1, AT 226593 T, DE 60000665 D1, EP 1264840 A1, JP 2002544287 A, ES 2185595 T3, AU 761591 B2,

Patent Title  Long-lasting antiviral fusion inhibitor peptide conjugates comprising albumin and human immunodeficiency virus (HIV) peptides

Comment  The peptide was potent inhibitors of HIV-1 infection and HIV induced cell-cell fusion, which derived from DP178.

Abstract  Peptides exhibiting anti-viral and anti-fusogenic activity are modified to provide greater stability and improved half-life in vivo. The selected peptides include fusion inhibitors DP178 and DP107 and related peptides and analogs thereof. The modified peptides are capable of forming covalent bonds with one or more blood components, preferably a mobile blood component.