DRAVP ID DRAVPa0863
Peptide Name Sequence 538 from Patent US 7582301 B1
Sequence YTSLIHRLIEESQNQQEKNEQELLELDKWASLWNWF
Sequence Length 36
Source Synthetic construct
Target Organism HIV
Patent Type Granted Patent
Publication Date 2009-09-01
Patent No US 7582301 B1
Family Info CA 2372338 A1, WO 2000/069902 A1, AU 2000/050271 A, EP 1179012 A1, BR 0010757 A, CN 1351611 A, EP 1179012 B1, AT 226593 T, DE 60000665 D1, EP 1264840 A1, JP 2002544287 A, ES 2185595 T3, AU 761591 B2,
Patent Title Long-lasting antiviral fusion inhibitor peptide conjugates comprising albumin and human immunodeficiency virus (HIV) peptides
Comment No comments found in patent
Abstract Peptides exhibiting anti-viral and anti-fusogenic activity are modified to provide greater stability and improved half-life in vivo. The selected peptides include fusion inhibitors DP178 and DP107 and related peptides and analogs thereof. The modified peptides are capable of forming covalent bonds with one or more blood components, preferably a mobile blood component.