Patent Information


DRAVP ID  DRAVPa0879

Peptide Name   Sequence 9 from Patent US 7575750 B2

Sequence  SLEQIWNNMTWEEWDREINNYTELIHELIEESQNQQEKNEQELLX

Sequence Length  45

Source  Synthetic construct

Target Organism  HIV, SIV

Patent Type  Granted Patent

Publication Date  2009-08-18

Patent No  US 7575750 B2

Family Info  WO 2004/029201 A2, CA 2500248 A1, AU 2003/275116 A1, WO 2004/029201 A3, US 2005/0089840 A1, EP 1542718 A2, AP 2005003291 A0, BR 0314657 A, CN 1668330 A, EA 200500533 A1, JP 2006505536 A, ZA 200503118

Patent Title  Human immunodeficiency virus (HIV) gp41 peptide derivatives with enhanced solubility and antiviral activity

Comment  The 'X' at position 45 represents a Lysine residue derivatized with a maleimide moiety.The peptide was modified with acetyl N-terminus and amide C-terminus, which exihibits antiviral activity by inhibiting viral infection of cells, for example, by inhibiting cell-cell fusion or free virus infection.

Abstract  This invention relates to gp41 peptide derivatives that are inhibitors of viral infection and/or exhibit antifusogenic properties. In particular, this invention relates to gp41 derivatives having inhibiting activity against human immunodeficiency virus (HIV) and simian immunodeficiency virus (SIV) with enhanced duration of action for the treatment of the respective viral infections.