Patent Information


DRAVP ID  DRAVPa0887

Peptide Name   Sequence 2 from Patent US 7556813 B2

Sequence  WNASWSNKSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF

Sequence Length  64

Source  Synthetic construct

Target Organism  HIV

Patent Type  Granted Patent

Publication Date  2009-07-07

Patent No  US 7556813 B2

Family Info  CA 2497767 A1, WO 2004/029073 A2, AU 2003/278937 A1, US 2004/0122214 A1, WO 2004/029073 A3, KR 20050046780 A, MX PA05003036 A, EP 1554306 A2, BR 0314707 A, RU 2005112729 A, CN 1684972 A, RU 2317997 C2

Patent Title  Antiviral peptide-polymer conjugate comprising a polymer covalently attached to two or more synthetic HIV gp41 HR1 and/or HR2 peptides

Comment  No comments found in patent

Abstract  Provided are conjugates comprising a polymer having operably bound thereto no less than two molecules of synthetic peptide derived from HIV gp41; methods of using these conjugates to inhibit transmission of HIV to a target cell by adding an amount of effective to inhibit infection of the cell by the virus; and methods of producing the conjugates by operably binding each molecule of synthetic peptide, via a reactive functionality, to the polymer.