DRAVP ID DRAVPa0920
Peptide Name Sequence 35 from Patent US 7556813 B2
Sequence NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQGGC
Sequence Length 41
Source Synthetic construct
Target Organism HIV
Patent Type Granted Patent
Publication Date 2009-07-07
Patent No US 7556813 B2
Family Info CA 2497767 A1, WO 2004/029073 A2, AU 2003/278937 A1, US 2004/0122214 A1, WO 2004/029073 A3, KR 20050046780 A, MX PA05003036 A, EP 1554306 A2, BR 0314707 A, RU 2005112729 A, CN 1684972 A, RU 2317997 C2
Patent Title Antiviral peptide-polymer conjugate comprising a polymer covalently attached to two or more synthetic HIV gp41 HR1 and/or HR2 peptides
Comment No comments found in patent
Abstract Provided are conjugates comprising a polymer having operably bound thereto no less than two molecules of synthetic peptide derived from HIV gp41; methods of using these conjugates to inhibit transmission of HIV to a target cell by adding an amount of effective to inhibit infection of the cell by the virus; and methods of producing the conjugates by operably binding each molecule of synthetic peptide, via a reactive functionality, to the polymer.