Patent Information


DRAVP ID  DRAVPa0938

Peptide Name   Sequence 53 from Patent US 7556813 B2

Sequence  WQEWDREITALLEQAQIQQEKNEYELQKLDEWEWF

Sequence Length  35

Source  Synthetic construct

Target Organism  HIV

Patent Type  Granted Patent

Publication Date  2009-07-07

Patent No  US 7556813 B2

Family Info  CA 2497767 A1, WO 2004/029073 A2, AU 2003/278937 A1, US 2004/0122214 A1, WO 2004/029073 A3, KR 20050046780 A, MX PA05003036 A, EP 1554306 A2, BR 0314707 A, RU 2005112729 A, CN 1684972 A, RU 2317997 C2

Patent Title  Antiviral peptide-polymer conjugate comprising a polymer covalently attached to two or more synthetic HIV gp41 HR1 and/or HR2 peptides

Comment  No comments found in patent

Abstract  Provided are conjugates comprising a polymer having operably bound thereto no less than two molecules of synthetic peptide derived from HIV gp41; methods of using these conjugates to inhibit transmission of HIV to a target cell by adding an amount of effective to inhibit infection of the cell by the virus; and methods of producing the conjugates by operably binding each molecule of synthetic peptide, via a reactive functionality, to the polymer.