To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
DRAVP ID DRAVPa0953
Peptide Name Sequence 68 from Patent US 7556813 B2
Sequence QARQLLSGIVQQQNNLLRAIEATQHAVQALVWGVKQLQARVLALERYIKDQ
Sequence Length 51
Source Synthetic construct
Target Organism HIV
Patent Type Granted Patent
Publication Date 2009-07-07
Patent No US 7556813 B2
Family Info CA 2497767 A1, WO 2004/029073 A2, AU 2003/278937 A1, US 2004/0122214 A1, WO 2004/029073 A3, KR 20050046780 A, MX PA05003036 A, EP 1554306 A2, BR 0314707 A, RU 2005112729 A, CN 1684972 A, RU 2317997 C2
Patent Title Antiviral peptide-polymer conjugate comprising a polymer covalently attached to two or more synthetic HIV gp41 HR1 and/or HR2 peptides
Comment No comments found in patent
Abstract Provided are conjugates comprising a polymer having operably bound thereto no less than two molecules of synthetic peptide derived from HIV gp41; methods of using these conjugates to inhibit transmission of HIV to a target cell by adding an amount of effective to inhibit infection of the cell by the virus; and methods of producing the conjugates by operably binding each molecule of synthetic peptide, via a reactive functionality, to the polymer.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.