To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
DRAVP ID DRAVPa1031
Peptide Name Sequence 4 from Patent US 6228983 B1
Sequence YTGIIYNLLEESQNQQEKNEQELLELDKWANLWNWF
Sequence Length 36
Source Synthetic construct
Target Organism HIV
Patent Type Granted Patent
Publication Date 2001-05-08
Patent No US 6228983 B1
Family Info WO 1996/019495 A1, CA 2208420 A1, AU 1996/044734 A, EP 0793675 A1, KR 987000333 A, EP 0793675 A4, AU 714695 B2, US 6013263 A, NZ 300002 A, US 6054265 A, US 6060065 A, US 6068973 A, US 6093794 A, US 62
Patent Title Human respiratory syncytial virus peptides with antifusogenic and antiviral activities
Comment No comments found in patent
Abstract The present invention relates to peptides which exhibit antifusogenic and antiviral activities. The peptides of the invention consist of a 16 to 39 amino acid region of a human respiratory syncytial virus protein. These regions were identified through computer algorithms capable of recognizing the ALLMOTI5, 107x178x4, or PLZIP amino acid motifs. These motifs are associated with the antifusogenic and antiviral activities of the claimed peptides.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.