DRAVP ID DRAVPa1185
Peptide Name Sequence 186 from Patent US 6228983 B1
Sequence YTSLIHSLIEQSQNQQEKNEQELLELDKWASLWNWF
Sequence Length 36
Source Synthetic construct
Target Organism HIV
Patent Type Granted Patent
Publication Date 2001-05-08
Patent No US 6228983 B1
Family Info WO 1996/019495 A1, CA 2208420 A1, AU 1996/044734 A, EP 0793675 A1, KR 987000333 A, EP 0793675 A4, AU 714695 B2, US 6013263 A, NZ 300002 A, US 6054265 A, US 6060065 A, US 6068973 A, US 6093794 A, US 62
Patent Title Human respiratory syncytial virus peptides with antifusogenic and antiviral activities
Comment The N teminal may be modified with an amino group,a hydrophobic group, an acetyl group, a 9-fluorenylmethoxycarbonyl group, or a macromolecular carrier group, and the C terminal may be modified with a carboxyl group, an amido group, a T-butyloxycarbonyl group, or a macromolecular carrier group.
Abstract The present invention relates to peptides which exhibit antifusogenic and antiviral activities. The peptides of the invention consist of a 16 to 39 amino acid region of a human respiratory syncytial virus protein. These regions were identified through computer algorithms capable of recognizing the ALLMOTI5, 107x178x4, or PLZIP amino acid motifs. These motifs are associated with the antifusogenic and antiviral activities of the claimed peptides.