Patent Information


DRAVP ID  DRAVPa1202

Peptide Name   Sequence 203 from Patent US 6228983 B1

Sequence  ASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDS

Sequence Length  45

Source  Synthetic construct

Target Organism  HIV

Patent Type  Granted Patent

Publication Date  2001-05-08

Patent No  US 6228983 B1

Family Info  WO 1996/019495 A1, CA 2208420 A1, AU 1996/044734 A, EP 0793675 A1, KR 987000333 A, EP 0793675 A4, AU 714695 B2, US 6013263 A, NZ 300002 A, US 6054265 A, US 6060065 A, US 6068973 A, US 6093794 A, US 62

Patent Title  Human respiratory syncytial virus peptides with antifusogenic and antiviral activities

Comment  The N teminal may be modified with an amino group,a hydrophobic group, an acetyl group, a 9-fluorenylmethoxycarbonyl group, or a macromolecular carrier group, and the C terminal may be modified with a carboxyl group, an amido group, a T-butyloxycarbonyl group, or a macromolecular carrier group.

Abstract  The present invention relates to peptides which exhibit antifusogenic and antiviral activities. The peptides of the invention consist of a 16 to 39 amino acid region of a human respiratory syncytial virus protein. These regions were identified through computer algorithms capable of recognizing the ALLMOTI5, 107x178x4, or PLZIP amino acid motifs. These motifs are associated with the antifusogenic and antiviral activities of the claimed peptides.