Patent Information


DRAVP ID  DRAVPa1551

Peptide Name   Sequence 90 from Patent US 20090105151

Sequence  SGSWLRDDWDWECTVLTDDKTWLQSKLDYKD

Sequence Length  31

Source  Hepatitis C virus

Target Organism  HCV

Patent Type  Patent Application

Publication Date  2009-04-23

Patent No  US 2009/0105151 A1

Family Info  WO 2009/014615 A2, US 2009/0105151 A1, WO 2009/014615 A3, US 8728793 B2

Patent Title  Amphipathic Alpha-Helical Peptide Compositions as Antiviral Agents

Comment  The peptide effects viral envelope disruption, which serves to inhibit viral infection, inhibit viral replication, reduce viral load and reduce infectivity. And It may be used to treat disease caused by one or more of the following viruses: poxvirus, baculovirus, paramyxoviruses, arenaviruses, herpesviruses (e.g., HSV (e.g., HSV1, HSV88), CMV, EBV, etc.), orthomyxoviruses, bunya viruses, coronaviruses, retroviruses (e.g., HIV), togaviruses, flaviviruses and hepadnaviruses.

Abstract  The invention features methods and compositions that exploit the ability of amphipathic alpha-helical (AH) peptides to cause disruption of lipid-containing vesicles, such as enveloped viruses, in a size-dependent manner.