DRAVP ID DRAVPa1551
Peptide Name Sequence 90 from Patent US 20090105151
Sequence SGSWLRDDWDWECTVLTDDKTWLQSKLDYKD
Sequence Length 31
Source Hepatitis C virus
Target Organism HCV
Patent Type Patent Application
Publication Date 2009-04-23
Patent No US 2009/0105151 A1
Family Info WO 2009/014615 A2, US 2009/0105151 A1, WO 2009/014615 A3, US 8728793 B2
Patent Title Amphipathic Alpha-Helical Peptide Compositions as Antiviral Agents
Comment The peptide effects viral envelope disruption, which serves to inhibit viral infection, inhibit viral replication, reduce viral load and reduce infectivity. And It may be used to treat disease caused by one or more of the following viruses: poxvirus, baculovirus, paramyxoviruses, arenaviruses, herpesviruses (e.g., HSV (e.g., HSV1, HSV88), CMV, EBV, etc.), orthomyxoviruses, bunya viruses, coronaviruses, retroviruses (e.g., HIV), togaviruses, flaviviruses and hepadnaviruses.
Abstract The invention features methods and compositions that exploit the ability of amphipathic alpha-helical (AH) peptides to cause disruption of lipid-containing vesicles, such as enveloped viruses, in a size-dependent manner.