Patent Information


DRAVP ID  DRAVPa1644

Peptide Name   Sequence 67 from Patent US 20090258815

Sequence  MPTEERVRKRKESNRESARRSRYRKAAHLK

Sequence Length  30

Source  Zea mays

Target Organism  Herpes viruse

Patent Type  Patent Application

Publication Date  2009-10-15

Patent No  US 2009/0258815 A1

Family Info  WO 2007/099993 A1, JP 2007230903 A, US 2009/0258815 A1, JP 4831410 B2, US 8138146 B2

Patent Title  Antiviral Peptide and Antiviral Agent

Comment  No cooments found in patent

Abstract  Disclosed is an antiviral agent comprising a non-naturally occurring, artificially synthesized peptide as the main ingredient. The antiviral agent comprises an antiviral peptide, wherein the antiviral peptide has at least one unit of an amino acid sequence constituted by at least five contiguous amino acid residues (which is known as a nuclear localization sequence (NLS)) or an amino acid sequence having a partial modification in the NLS and also having at least one unit of an amino acid sequence constituted by at least five contiguous amino acid residues (which is known as a nuclear export sequence (NES)) or an amino acid sequence having a partial modification in the NES.