DRAVP ID DRAVPa1644
Peptide Name Sequence 67 from Patent US 20090258815
Sequence MPTEERVRKRKESNRESARRSRYRKAAHLK
Sequence Length 30
Source Zea mays
Target Organism Herpes viruse
Patent Type Patent Application
Publication Date 2009-10-15
Patent No US 2009/0258815 A1
Family Info WO 2007/099993 A1, JP 2007230903 A, US 2009/0258815 A1, JP 4831410 B2, US 8138146 B2
Patent Title Antiviral Peptide and Antiviral Agent
Comment No cooments found in patent
Abstract Disclosed is an antiviral agent comprising a non-naturally occurring, artificially synthesized peptide as the main ingredient. The antiviral agent comprises an antiviral peptide, wherein the antiviral peptide has at least one unit of an amino acid sequence constituted by at least five contiguous amino acid residues (which is known as a nuclear localization sequence (NLS)) or an amino acid sequence having a partial modification in the NLS and also having at least one unit of an amino acid sequence constituted by at least five contiguous amino acid residues (which is known as a nuclear export sequence (NES)) or an amino acid sequence having a partial modification in the NES.