DRAVP ID DRAVPa1801
Peptide Name Sequence 22 from Patent US20040229219 A1
Sequence YINVTFLDLQVEMNRLQEAIKVLNQSYINLKDIGTYEYYVKW
Sequence Length 42
Source Human coronavirus
Target Organism SARS
Patent Type Patent Application
Publication Date 2004-11-18
Patent No US20040229219 A1
Family Info WO/2005/007078
Patent Title Method of inhibiting human metapneumovirus and human coronavirus in the prevention and treatment of severe acute respiratory syndrome (SARS)
Comment
Abstract The present invention relates to peptides that show significant antiviral activity against viral respiratory disease. More particularly, the invention relates to the use of peptides to inhibit membrane fusion and infection by human metapneumovirus and/or human coronavirus in the prevention and treatment of Severe Acute Respiratory Syndrome (SARS) or other severe respiratory diseases caused by theses agents. The peptides are derived from the known amino acid sequence of the fusion glycoproteins of each virus.