Patent Information


DRAVP ID  DRAVPa1827

Peptide Name   Sequence 49 from Patent US20040229219 A1

Sequence  PNPPDFKEELDKWFKNQTSIAPDLSLDFEKLNVTLLDLTYEMNRIQDAIKKLNESYINLKEVGTYEMYVKWPWYVWLLIGLAGVA

Sequence Length  85

Source  Mouse hepatitis virus

Target Organism  SARS

Patent Type  Patent Application

Publication Date  2004-11-18

Patent No  US20040229219 A1

Family Info  WO/2005/007078

Patent Title  Method of inhibiting human metapneumovirus and human coronavirus in the prevention and treatment of severe acute respiratory syndrome (SARS)

Comment 

Abstract  The present invention relates to peptides that show significant antiviral activity against viral respiratory disease. More particularly, the invention relates to the use of peptides to inhibit membrane fusion and infection by human metapneumovirus and/or human coronavirus in the prevention and treatment of Severe Acute Respiratory Syndrome (SARS) or other severe respiratory diseases caused by theses agents. The peptides are derived from the known amino acid sequence of the fusion glycoproteins of each virus.