Patent Information


DRAVP ID  DRAVPa2169

Peptide Name   Sequence 17 from Patent US9822155B2

Sequence  KHRNGAICWGPCPTAFRQIGNCGHFKVRCCKIR

Sequence Length  33

Source  Synthetic peptide

Target Organism  Influenza A virus

Patent Type  Granted Patent

Publication Date  2017-11-21

Patent No  US9822155B2

Family Info  WO2014180180A1, HK1190738A1, KR101800951B1, MX346160B, RU2639559C2, CN103554244B

Patent Title  Method of preventively treating a subject at the risk of developing infections of a respiratory virus

Comment 

Abstract  A method of preventively treating a subject at the risk of developing infections of a respiratory virus is disclosed. The method includes a step of administering to the subject an effective amount of a peptide synthesized through a chemical route or by a genetic engineering process, characterized in that the peptide has a functional domain capable of binding to a surface glycoprotein of a respiratory virus and has an activity of inhibiting infection of the respiratory virus, wherein the peptide has 5 or more basic amino acids, among which 2 or more basic amino acids are in N-terminal region or C-terminal region of the peptide; and wherein the peptide consists of an amino acid sequence that is at least 90% identical to SEQ ID NO: 19. The invention also discloses the mechanism of the peptides in inhibition of said infections, which provides theory support for developing new prophylactic/therapeutic agents with broad-spectrum antiviral activities.