To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
DRAVP ID DRAVPa2226
Peptide Name Sequence 31 from Patent US20210380642B2
Sequence RQWIPAGIGITGIIIAIIALLCVCKLLGSGKKRTLRKNDRKKR
Sequence Length 43
Source Synthetic peptide
Target Organism Ebolavirus，Marburg virus
Patent Type Granted Patent
Publication Date 2023-09-26
Patent No US20210380642B2
Family Info JP2021187810
Patent Title Antiviral peptide and use thereof
Comment
Abstract The synthetic peptide disclosed here includes (1) an amino acid sequence represented by any of SEQ ID NOS:1 to 10, or a modified amino sequence formed by deletion, substitution or addition of 1, 2 or 3 amino acid residues in any of these amino acid sequences, together with (2) an amino acid sequence (CPP sequence) that functions as a cell penetrating peptide (CPP), and consists of a total of not more than 102 amino acid residues.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.