To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
DRAVP ID DRAVPa2313
Peptide Name Sequence 4 from Patent CN118451094A
Sequence GAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Sequence Length 30
Source Synthetic peptide
Target Organism SARS-CoV-2
Patent Type Patent Application
Publication Date 2024-08-06
Patent No CN118451094A
Family Info WO/2023/125432, EP4457237
Patent Title Antiviral peptides and methods of use thereof
Comment
Abstract Antiviral peptides and formulations thereof for treating or preventing one or more symptoms of coronavirus infection are described. Peptides derived from human beta defensin 4 have been demonstrated to have antiviral properties against different coronavirus variants, including cross-linking viral particles, blocking intercellular fusion, and/or inhibiting viral release. Pharmaceutical compositions and methods of using one or more antiviral peptides are also provided. Preferably, the antiviral peptides are administered via an intranasal route to prevent or alleviate one or more symptoms of coronavirus infection, such as reducing syncytial formation and lung injury.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.