Patent Information


DRAVP ID  DRAVPa2314

Peptide Name   Sequence 1 from Patent CN108409866A

Sequence  QPSVQIQVYQGEREIAAHAAAKLPDLCTEL

Sequence Length  30

Source  Synthetic peptide

Target Organism  HPV

Patent Type  Patent Application

Publication Date  2018-08-17

Patent No  CN108409866A

Family Info  WO/2019/144607

Patent Title  Multi-epitope combined peptide used for treating and preventing human papillomavirus infection and related diseases

Comment 

Abstract  The invention relates to a multi-epitope combined peptide used for treating and preventing human papillomavirus (HPV) infection and related diseases. The multi-epitope combined peptide consists of a binding domain and a hinge domain of carboxyl-terminated peptide of mycobacterium tuberculosis heat shock protein 70 (HSP70), and antigen epitope peptides of T cells of HPV E6 and E7, and the multi-epitope combined peptide is in linear arrangement through the arrangement mode of HSP stimulated epitope peptide-hinge area-HPV CTL epitope. The multi-epitope combined peptide provided by the invention can be used as a vaccine to induce the immune response mediated by specific T lymphocytes through injection of intradermal, hypodermic, focus or mucosal tissues, and can induce effective antiviral effect in tissues and local tissues for treating and preventing HPV infection and related diseases. The multi-epitope combined peptide provided by the invention has the advantages of low use dose and no need of adding artificial excipients.