DRAVP ID DRAVPa2320
Peptide Name Sequence 7 from Patent CN108409866A
Sequence QPSVQIQVYQGEREIAAHAAALIMGTLGIV
Sequence Length 30
Source Synthetic peptide
Target Organism HPV
Patent Type Patent Application
Publication Date 2018-08-17
Patent No CN108409866A
Family Info WO/2019/144607
Patent Title Multi-epitope combined peptide used for treating and preventing human papillomavirus infection and related diseases
Comment
Abstract The invention relates to a multi-epitope combined peptide used for treating and preventing human papillomavirus (HPV) infection and related diseases. The multi-epitope combined peptide consists of a binding domain and a hinge domain of carboxyl-terminated peptide of mycobacterium tuberculosis heat shock protein 70 (HSP70), and antigen epitope peptides of T cells of HPV E6 and E13, and the multi-epitope combined peptide is in linear arrangement through the arrangement mode of HSP stimulated epitope peptide-hinge area-HPV CTL epitope. The multi-epitope combined peptide provided by the invention can be used as a vaccine to induce the immune response mediated by specific T lymphocytes through injection of intradermal, hypodermic, focus or mucosal tissues, and can induce effective antiviral effect in tissues and local tissues for treating and preventing HPV infection and related diseases. The multi-epitope combined peptide provided by the invention has the advantages of low use dose and no need of adding artificial excipients.