DRAVP ID  DRAVPa2458

Peptide Name   Sib3

Sequence  KINKQKIKNGAKKALGVASKVAPVVAAFAR

Sequence Length  30

Source  Simulium bannaense

Target Organism  ZIKV

Patent Type  Patent Application

Publication Date  2024-04-26

Patent No  CN117919378A

Family Info  CN 117919378 A

Patent Title  Application of Simulium bannaense host defense peptide Siba3

Comment 

Abstract  The invention discloses an application of a Simulium bannaense host defense peptide Siba3. The invention also discloses an application of the Simulium bannaense host defense peptide Siba3 in preparation of a medicine for resisting Zika virus infection diseases. The amino acid sequence of the Simulium bannaense host defense peptide Siba3 is as follows: KINKQKIKNGAKKALGVASKVAPVVAAFAR-NH2, and the amino acid sequence of the Simulium bannaense host defense peptide Siba3 is as follows. According to the invention, a host defense peptide Siba3 derived from Simulium bannaense is taken as a research object, and the effect of Siba3 in ZIKV infection is planned to be clarified. Research finds that Siba3 can significantly inhibit ZIKV infection in vitro and also can significantly inhibit ZIKV infection in vivo, and has both prevention and treatment effects. Results show that Siba3 can directly act on ZIKV, destroy virus envelopes and induce virus genomes to leak, so that virus particles are inactivated; the Siba3 can also reduce the susceptibility of the host cell to the Zika virus. The molecular weight is small, the structure is simple, and therefore the wide development and application prospects are achieved.