Patent Information


DRAVP ID  DRAVPa2558

Peptide Name   T-198

Sequence  SVALDPIDISIELNKAKSDLEESKEWIRRSNQKL

Sequence Length  34

Source  HPIV3 fusion (F) protein

Target Organism  HPIV 3

Patent Type  Granted Patent

Publication Date  2002-08-27

Patent No  US6440656

Family Info  WO9428920A1, US7514397B1, US5464933A, US6133418A, AU692777B2, AU7042694A, CA2164698A1, CA2164698C, EP1595890A3, ES2238674T3, JP4205159B2, JPH08511525A, KR100355407B1

Patent Title  Methods for the inhibition of respiratory syncytial virus transmission

Comment 

Abstract  Fusion of the viral envelope, or infected cell membranes with uninfected cell membranes, is an essential step in the viral life cycle. Recent studies involving the human immunodeficiency virus type 1 (HIV-1) demonstrated that synthetic peptides (designated DP-107 and DP-178) derived from potential helical regions of the transmembrane (TM) protein, gp41, were potent inhibitors of viral fusion and infection. A computerized antiviral searching technology (C.A.S.T.) that detects related structural motifs (e.g., ALLMOTI5, 107x178x4, and PLZIP) in other viral proteins was employed to identify similar regions in the respiratory syncytial virus (RSV). Several conserved heptad repeat domains that are predicted to form coiled-coil structures with antiviral activity were identified in the RSV genome. Synthetic peptides of 16 to 39 amino acids derived from these regions were prepared and their antiviral activities assessed in a suitable in vitro screening assay. These peptides proved to be potent inhibitors of RSV fusion. Based upon their structural and functional equivalence to the known HIV-1 inhibitors DP-107 and DP-218, these peptides should provide a novel approach to the development of targeted therapies for the treatment of RSV infections.