DRAVPR ID  DRAVPR0007

Name   Neuromedin-B receptor(NMB-R)

Sequence  MPPRSLSNLSFPTEANESELVPEVWEKDFLPDSDGTTAELVIRCVIPSLYLIIISVGLLGNIMLVKIFLTNSAMRNVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWVFGKLGCKLIPAIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGVLLWTSLKAVGIWVVSVLLAVPEAVFSEVARIGSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLVIISIYYYHIAKTLIKSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFVFCWFPNHVLYLYRSFNYKEIDPSLGHMIVTLVARVLSFSNSCVNPFALYLLSESFRKHFNSQLCCGRKSYPERSTSYLLSSSAVRMTSLKSNTKNVVTNSVLLNGHSTKQEIAL

Sequence Length  390

Source  Mus musculus (Mouse)

UniProt ID O54799

Gene Nmbr

Target Organism  IAV

Activity 

• [Ref.31601264]Influenza virus strain A/Puerto Rico/8/1934 (H1N1):Neuromedin-B receptor plays a role in the innate immune response to influenza A virus infection by enhancing interferon alpha expression and reducing expression of IL6.

PDB ID  None

Predicted Structure Download  AF-O54799-F1

Modification  ①Glycosylation of Asn at position 8, 16, 192.②The Cys at position 341 indicates S-palmitoyl cysteine.③Phosphorylation of Ser at position 352.④There is a disulfide bond between cys116 and Cys198.

The NMB/NMBR system appeared to increase IFN-α expression and decrease IL-6 expression after PR8 infection, which may serve to establish an antiviral state in the host.

Literature 1

Title   Role of neuromedin B and its receptor in the innate immune responses against influenza A virus infection in vitro and in vivo.

Pubmed ID   31601264

Author   Yang G, Huang H, Tang M, Cai Z, Huang C, Qi B, Chen JL.