DRAVPR ID  DRAVPR0008

Name   Neuromedin-B

Sequence  MARRAGGARMFGSLLLFALLAAGVAPLSWDLPEPRSRASKIRVHSRGNLWATGHFMGKKSLEPSSPSPLGTAPHTSLRDQRLQLSHDLLGILLLKKALGVSLSRPAPQIQYRRLLVQILQK

Sequence Length  121

Source  Homo sapiens (Human)

UniProt ID P08949

Gene NMB

Target Organism  IAV

Activity 

• [Ref.31601264]Influenza virus strain A/Puerto Rico/8/1934 (H1N1): NMR up-regulated in response to infection with influenza A virus.

PDB ID  1C98  1C9A 

Predicted Structure Download  AF-P08949-F1

Modification  The Met at position 56 is amidation.

It is likely that NMB plays an anti-inflammatory role via the regulation of the host type I IFN signalling pathway. The NMB/NMBR system appeared to increase IFN-α expression and decrease IL-6 expression after PR8 infection, which may serve to establish an antiviral state in the host.

Literature 1

Title   Role of neuromedin B and its receptor in the innate immune responses against influenza A virus infection in vitro and in vivo.

Pubmed ID   31601264

Author   Yang G, Huang H, Tang M, Cai Z, Huang C, Qi B, Chen JL.