DRAVPR ID  DRAVPR0014

Name   Interferon alpha-inducible protein 27(ISG12a)

Sequence  MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAMAAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY

Sequence Length  122

Source  Homo sapiens (Human)

UniProt ID P40305

Gene IFI27

Target Organism  HCV

Activity 

• [Ref.27194766]Hepatitis C virus (HCV):ISG12a mediates NS5A degradation via a ubiquitination-dependent proteasomal pathway, which is a multifunctional protein is indispensable for HCV replication and virus production.

PDB ID  None

Predicted Structure Download  AF-P40305-F1

Modification  No modifications on the sequence.

ISG12a relies on the E3 ligase domain of SKP2 to restrict viral infection.The antiviral effects of ISG12a/IFI27 on HCV, NDV, WNV, and mouse hepatitis virus (MHV) infection in vitro or in vivo have been determined.

Literature 1

Title   ISG12a Restricts Hepatitis C Virus Infection through the Ubiquitination-Dependent Degradation Pathway.

Pubmed ID   27194766

Author   Xue B, Yang D, Wang J, Xu Y, Wang X, Qin Y, Tian R, Chen S, Xie Q, Liu N, Zhu H.

Literature 2

Title   ISG12a inhibits HCV replication and potentiates the anti-HCV activity of IFN-α through activation of the Jak/STAT signaling pathway independent of autophagy and apoptosis.

Pubmed ID   27777077

Author   Chen Y, Jiao B, Yao M, Shi X, Zheng Z, Li S, Chen L.