DRAVPR ID  DRAVPR0023

Name   Interferon-induced transmembrane protein 1(IFITM1)

Sequence  MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY

Sequence Length  125

Source  Homo sapiens (Human)

UniProt ID P13164

Gene IFITM1

Target Organism  HCV,SARS-CoV-2

Activity 

• [Ref.26354436]Hepatitis C Virus(HCV):IFITM1 to be able to limit HCV infection at the level of HCV entry through an interaction with the essential entry co-receptor CD81.
• [Ref.33270927]SARS-CoV-2:IFITM1 likely restrict SARS‐CoV‐2 infection by mechanically disfavoring viral membrane fusion reactions occurring at endosomes.

PDB ID  None

Predicted Structure Download  AF-P13164-F1

Modification  ①Phosphorylation of Ser at position 16.②The Cys at position 50,51,84 indicates S-palmitoyl cysteine.

IFITM1, IFITM2, and IFITM3 primarily act on the early stages of HCV infection.Active against multiple viruses, including influenza A virus, SARS coronaviruses (SARS-CoV and SARS-CoV-2), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1) and hepatitis C virus (HCV).

Literature 1

Title   The Interferon-induced Transmembrane Proteins, IFITM1, IFITM2, and IFITM3 Inhibit Hepatitis C Virus Entry. 

Pubmed ID   26354436

Author   Narayana SK, Helbig KJ, McCartney EM, Eyre NS, Bull RA, Eltahla A, Lloyd AR, Beard MR.

Literature 2

Title   Opposing activities of IFITM proteins in SARS-CoV-2 infection.

Pubmed ID   33270927

Author   Shi G, Kenney AD, Kudryashova E, Zani A, Zhang L, Lai KK, Hall-Stoodley L, Robinson RT, Kudryashov DS, Compton AA, Yount JS.

Literature 3

Title   Syncytia formation by SARS-CoV-2-infected cells.

Pubmed ID   33051876

Author   Buchrieser J, Dufloo J, Hubert M, Monel B, Planas D, Rajah MM, Planchais C, Porrot F, Guivel-Benhassine F, Van der Werf S, Casartelli N, Mouquet H, Bruel T, Schwartz O.