DRAVPR ID  DRAVPR0024

Name   Interferon-induced transmembrane protein 2(IFITM2)

Sequence  MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWSLFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILLIIIPVLVVQAQR

Sequence Length  132

Source  Homo sapiens (Human)

UniProt ID Q01629

Gene IFITM2

Target Organism  HCV,SARS-CoV-2

Activity 

• [Ref.26354436]Hepatitis C Virus(HCV):inhibiting the late stages of HCV entry, possibly in a coordinated manner by trapping the virion in the endosomal pathway and targeting it for degradation at the lysosome.
• [Ref.33270927]SARS-CoV-2:IFITM2 likely restrict SARS‐CoV‐2 infection by mechanically disfavoring viral membrane fusion reactions occurring at endosomes.

PDB ID  None

Predicted Structure Download  AF-Q01629-F1

Modification  ①Phosphorylation of Ser at position 19.②The Cys at position 70,71,104 indicates S-palmitoyl cysteine.

IFITM1, IFITM2, and IFITM3 primarily act on the early stages of HCV infection.Active against multiple viruses, including influenza A virus, SARS coronaviruses (SARS-CoV and SARS-CoV-2), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1), hepatitis C virus (HCV) and vesicular stomatitis virus (VSV)

Literature 1

Title   The Interferon-induced Transmembrane Proteins, IFITM1, IFITM2, and IFITM3 Inhibit Hepatitis C Virus Entry. 

Pubmed ID   26354436

Author   Narayana SK, Helbig KJ, McCartney EM, Eyre NS, Bull RA, Eltahla A, Lloyd AR, Beard MR.

Literature 2

Title   Opposing activities of IFITM proteins in SARS-CoV-2 infection.

Pubmed ID   33270927

Author   Shi G, Kenney AD, Kudryashova E, Zani A, Zhang L, Lai KK, Hall-Stoodley L, Robinson RT, Kudryashov DS, Compton AA, Yount JS.