DRAVPR ID  DRAVPR0049

Name   Radical S-adenosyl methionine domain-containing protein 2(Viperin)

Sequence  MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETKEEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW

Sequence Length  361

Source  Homo sapiens (Human)

UniProt ID Q8WXG1

Gene RSAD2

Target Organism  ZIKV,WNV,DENV,HCV,EVA71,HSV-1

Activity 

• [Ref.29925952]Zika virus(ZIKV)/west nile virus(WNV)/dengue virus (DENV)/hepatitis C virus(HCV):viperin catalyzes the conversion of cytidine triphosphate (CTP) to 3′-deoxy-3′,4′-didehydro-CTP (ddhCTP),and inhibits in vivo replication of ZIKA virus.
• [Ref.30587778]Enterovirus A71 (EVA71):amino acids 50–60 in the N-terminal domain of viperin were the key residues responsible for viperin interaction with 2C, the N-terminal domain of viperin was found responsible for inhibiting EVA71 replication.
• [Ref.31921110]Herpes Simplex Virus 1(HSV-1):gD(Glycoprotein D) of HSV-1 and viperin interaction inhibits HSV-1 replication.

PDB ID  None

Predicted Structure Download  No predicted structure information available for the entry

Modification  The Lys at position 197 idnicates N6-acetyllysine.

The SAM and N-terminal viperin domains were most important for CSFV and PEDV inhibition.

Literature 1

Title   A naturally occurring antiviral ribonucleotide encoded by the human genome. 

Pubmed ID   29925952

Author   Gizzi AS, Grove TL, Arnold JJ, Jose J, Jangra RK, Garforth SJ, Du Q, Cahill SM, Dulyaninova NG, Love JD, Chandran K, Bresnick AR, Cameron CE, Almo SC.

Literature 2

Title   Viperin Inhibits Enterovirus A71 Replication by Interacting with Viral 2C Protein.

Pubmed ID   30587778

Author   Wei C, Zheng C, Sun J, Luo D, Tang Y, Zhang Y, Ke X, Liu Y, Zheng Z, Wang H.

Literature 3

Title   The Interaction Mechanism Between Herpes Simplex Virus 1 Glycoprotein D and Host Antiviral Protein Viperin.

Pubmed ID   31921110

Author   Li M, Liao Z, Xu Z, Zou X, Wang Y, Peng H, Li Y, Ou X, Deng Y, Guo Y, Gan W, Peng T, Chen D, Cai M.