DRAVPR ID  DRAVPR0050

Name   Radical S-adenosyl methionine domain-containing protein 2

Sequence  MWTLVPVTFALRLLSTFVQPLGSLGSSLGPLFLWLWAAFWRAGGDRSRQQLQGKTEAGEPPRAQEDSHLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLWLLKEAGMEKINFSGGEPFIHDRGEYLGKLVRFCKEELQLPSVSIVSNGSLIWERWFKSYGEYLDILAISCDSFDEQVNVLIGRGQGKKNHVENLQKLRTWCRDYKVAFKINSVINRFNVEEDMTEHIKALNPVRWKVFQCLLIEGENVGEDALREAEQFVISDEEFEEFLDRHKDVSCLVPESNRQMRDSYLILDEYMRFLNCRNGRKDPSKSILDVGVEKAIKFSGFDEKMFLKRGGKYVWSKADLKLDW

Sequence Length  362

Source  Sus scrofa (Pig)

UniProt ID Q9MZU4

Gene RSAD2

Target Organism  PEDV,CSFV

Activity 

• [Ref.32719955]Porcine epidemic diarrhea virus(PEDV):The interaction of the viperin S-adenosylmethionine domain with the N protein of PEDV might interfere with viral replication or assembly to reduce virus proliferation.
• [Ref.31517388]Classical swine fever virus (CSFV):Viperin inhibits the replication of CSFV by interacting with viral nonstructural 5A protein.

PDB ID  None

Predicted Structure Download  AF-Q9MZU4-F1

Modification  The Lys at position 198 idnicates N6-acetyllysine.

No comments found in the entry

Literature 1

Title   The antiviral protein viperin interacts with the viral N protein to inhibit proliferation of porcine epidemic diarrhea virus.

Pubmed ID   32719955

Author   Wu J, Chi H, Fu Y, Cao A, Shi J, Zhu M, Zhang L, Hua D, Huang J.

Literature 2

Title   Viperin inhibits classical swine fever virus replication by interacting with viral nonstructural 5A protein.

Pubmed ID   31517388

Author   Xu C, Feng L, Chen P, Li A, Guo S, Jiao X, Zhang C, Zhao Y, Jin X, Zhong K, Guo Y, Zhu H, Han L, Yang G, Li H, Wang Y.