DRAVPR ID  DRAVPR0144

Name   TnGlv1

Sequence  MQLSTIFCFAVLIACARAQVFVKPGHKDEDLAWMRSMGKGHVFGTLGSTDGSLIGKLGYKQNIYNDQRGNLGGTAYGSRVINEYGGTSSFGGKLDWKNANDNARASLDVHKQVGGSSGMTLTGDGVWKLDSKTRLVAGGNLDKTFGYSKPELGIQAKIEHDFK

Sequence Length  163

Source  hemocytes, Trichoplusia ni

UniProt ID Q9GQM3

Gene  T. ni gloverin

Target Organism  AcMNPV-BV

Activity 

• [Ref:22401766]BV:When BV was incubated with gloverin-containing supernatants, the quantity of infectious BV, as measured by PFU, was reduced to 26.6 ± 3.4 % and 8.3 ± 1.6 % for TnGlv1 and TnGlv2, relative to that of BV incubated in the presence of vehicle (Figure DAB). A higher quantity of infectious virus was detected for BV incubated in the presence of TnGlv1 and TnGlv2 purified using Ni-NTA affinity columns (60.8 ± 4.5 % and 36.3 ± 5.8 % of vehicle, respectively. These results suggest that TnGlv1 and TnGlv2 inactivate baculovirus BV in vitro and that TnGlv2 has greater antiviral activity than TnGlv1

PDB ID  None

Predicted Structure Download  No predicted structure information available for the entry

Modification  Reverse PCR primers were designed to remove the stop codon while maintaining the sequence in frame for fusion of a C-terminal V5 epitope and 6x-His tag.

No comments found in the entry

Literature 1

Title   Inactivation of the budded virus of Autographa californica M nucleopolyhedrovirus by gloverin

Pubmed ID   22401766

Author   Moreno-Habel DA, Biglang-awa IM, Dulce A, Luu DD, Garcia P, Weers PM, Haas-Stapleton EJ