DRAVPR ID  DRAVPR0161

Name   Y3

Sequence  AACARFIDDFCDTLTPNIYRPRDNGQRCYAVNGHRCDFTVFNTNNGGNPIRASTPNCKTVLRTAANRCPTGGRGKINPNAPFLFAIDPNDGDCSTNF

Sequence Length  97

Source  Golden oyster mushroom, Pleurotus citrinopileatus

UniProt ID P83811

Gene Antiviral protein CAP

Target Organism  TMV

Activity 

• Antiviral protein Y3: at 2.0 ug/ml achieved 50.0% inhibition of tobacco mosaic virus (TMV, 20 ug/ml) lesions in Nicotiana glutinosa leaves. (provided by Chunfeng Wang). Submitted OCT-2002 to the SWISS-PROT data bank. It shows antiviral activity against Tobacco mosaic virus and antitumor activity against stomach cancer cells in vitro. Full sequence updated 03/12 GW.

PDB ID  None

Predicted Structure Download  No predicted structure information available for the entry

Modification  No modifications on the sequence.

No comments found in the entry

Literature 1

Title   Characterization and amino acid sequence of y3, an antiviral protein from mushroom Coprinus comatus

Pubmed ID   Not Available

Author   Wu,L.-P., Wu,Z.-J., Lin,D, Fang F, Lin Q.-Y., Xie,L.-H.2002