DRAVPR ID  DRAVPR0162

Name   ΔABP-D25Y

Sequence  GSHMGDAQDKLKYLVKQLERALRELKKSLDELERSLEELEKNPSEDALVENNRLNVENNKIIVEVLRIILELAKASAKLA

Sequence Length  80

Source  ACE2

UniProt ID None

Gene Not Available

Target Organism  SARS-CoV-2

Activity 

• [Ref:33002032]SARS-Cov-2:The inhibitor consists of two α helical peptides homologues to protease domain (PD) of ACE2. Docking studies and molecular dynamic simulation revealed that the inhibitor binds exclusively at the ACE2 binding site of S protein. The computed binding affinity of the inhibitor is higher than the ACE2 and thus will likely out compete ACE2 for binding to S protein. Hence, the proposed inhibitor ΔABP-D25Y could be a potential blocker of S protein and receptor binding domain (RBD) attachment.

PDB ID  None

Predicted Structure Download  No predicted structure information available for the entry

Modification  No modifications on the sequence.

No comments found in the entry

Literature 1

Title   In-silico design of a potential inhibitor of SARS-CoV-2 S protein

Pubmed ID   33002032

Author   Jaiswal G, Kumar V.