DRAVPR ID  DRAVPR0168

Name   Elafin

Sequence  AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

Sequence Length  57

Source  skin, Homo sapiens

UniProt ID P19957

Gene PI3

Target Organism  HIV-1, HSV-2

Activity 

• [Ref:23637403]HIV-1Serine protease inhibitor elafin (E) and its precursor, trappin-2 (Tr), have been associated with mucosal resistance to HIV-1 infection. We recently showed that Tr/E are among principal anti-HIV-1 molecules in cervicovaginal lavage (CVL) fluid, that E is ∼130 times more potent than Tr against HIV-1, and that Tr/E inhibited HIV-1 attachment and transcytosis across human genital epithelial cells (ECs). [Ref:22345469]HSV-2:Since herpes simplex virus 2 (HSV-2) is a major sexually transmitted infection and risk factor for HIV-1 infection and transmission, we assessed Tr/E contribution to defense against HSV-2. 

PDB ID  2REL 

Predicted Structure Download  No predicted structure information available for the entry

Modification  No modifications on the sequence.

No comments found in the entry

Literature 1

Title   Antiviral activity of trappin-2 and elafin in vitro and in vivo against genital herpes;

Pubmed ID   23637403

Author   Drannik, A. G., Nag, K., Sallenave, J. M., & Rosenthal, K. L. (2013)

Literature 2

Title   Anti-HIV-1 activity of elafin is more potent than its precursor's, trappin-2, in genital epithelial cells

Pubmed ID   22345469

Author   Drannik, A. G., Nag, K., Yao, X. D., Henrick, B. M., Jain, S., Ball, T. B., Plummer, F. A., Wachihi, C., Kimani, J., & Rosenthal, K. L. (2012).