DRAVPR ID  DRAVPR0170

Name   SVN

Sequence  GSGPTYCWNEANNPGGPNRCSNNKQCDGARTCSSSGFCQGTSRKPDPGPKGPTYCWDEAKNPGGPNRCSNSKQCDGARTCSSSGFCQGTAGHAAA

Sequence Length  95

Source  cyanobacterium, Scytonema varium

UniProt ID P86041

Gene Not available

Target Organism  HIV

Activity 

• [Ref:2614152]HIV:Has strong anti-HIV activity against T-tropic strains of HIV-1 and weaker activity against M-tropic strains of HIV-1. Inhibits HIV-1 fusion and infection of CD4 LTR beta-gal cells in vitro. Inhibits fusion of HIV infected CEM-SS cells with uninfected CEM-SS cells, and fusion of HIV-1 Env expressing HL2/3 cells with CD4 LTR beta-gal cells. Binds to HIV gp120, HIV gp160 and to a lesser extent HIV gp41. Binding to HIV gp120 is glycosylation dependent. Binds with high specificity to the tetrasaccharide Man-alpha-1,2-Man-alpha-1,6-Man-alpha-1,6-Man and also binds the higher-order oligosaccharides oligomannose 8 and oligomannose 9. Does not bind to monosaccharides, complex or hybrid N-linked oligosaccharides or chitin.

PDB ID  2QSK  2JMV 

Predicted Structure Download  No predicted structure information available for the entry

Modification  The five disulfide bonds are proposed as Cys7-Cys55, Cys20-Cys32, Cys26-Cys38, Cys68-Cys80, and Cys74-Cys86

No comments found in the entry

Literature 1

Title   A potent novel anti-HIV protein from the cultured cyanobacterium Scytonema varium

Pubmed ID   2614152

Author   Bokesch, H. R., O'Keefe, B. R., McKee, T. C., Pannell, L. K., Patterson, G. M., Gardella, R. S., Sowder, R. C., 2nd, Turpin, J., Watson, K., Buckheit, R. W., Jr, & Boyd, M. R. (2003).