DRAVPR ID  DRAVPR0171

Name   Antiviral protein Y3

Sequence  AACARFIDDFCDTLTPNIYRPRDNGQRCYAVNGHRCDFTVFNTNNGGNPIRASTPNCKTVLRTAANRCPTGGRGKIN

Sequence Length  77

Source  Golden oyster mushroom, Pleurotus citrinopileatus

UniProt ID P83811

Gene Not Available

Target Organism  TMV

Activity 

• [Ref:32711757]TMV:Compared with the control (TMV mixed with PBS buffer), the TMV concentrations of the tobacco plants treated with the different proteins were significantly lower. Y3 shown to be able to activate the expression of a number of defence-related genes.Some of the mechanisms of its protection can be attributed to a direct interaction between Y3 and TMV-CP.

PDB ID  None

Predicted Structure Download  No predicted structure information available for the entry

Modification  disulfide bonds

When Phe at the 43rd amino acid of Y3 was replaced by Cys, the predicted disulfide bonds were changed, and the interaction of Y3-CP and Y3T1 (mutated Y3) could not be detected by BiFC

Literature 1

Title   Inhibitory effect of protein Y3 from Coprinus comatus on tobacco mosaic virus

Pubmed ID   32711757

Author   Xiao H, Bian Y, Huang H, Zhang Z, Wu L, Wu L.