DRAVPR ID  DRAVPR0172

Name   Apl-AvBD16

Sequence  FFLLFLQGAAGNSVLCRIRGGRCHVGSCHFPERHIGRCSGFQACCIRTWG

Sequence Length  50

Source  Peking duck, Anas platyrhynchos

UniProt ID I1W762

Gene Not Available

Target Organism  DHV

Activity 

• [ref:23112840]DHV:The level of expression of AvBD16 in both the bursa of Fabricius and the spleen was increased significantly at 24 h after infection (P<0.05 or P<0.01), and significant induction was observed in the liver (at 24 h and 96 h) in response to infection.  the mRNA of the Apl_AvBD16 was upregulated in various immune tissues and in the livers of ducks following DHV infection. These findings provide evidence that the defensins activate the immune response to combat microbial infection.

PDB ID  None

Predicted Structure Download  No predicted structure information available for the entry

Modification  No modifications on the sequence.

No comments found in the entry

Literature 1

Title   Identification, expression and activity analyses of five novel duck beta-defensins

Pubmed ID   23112840

Author   Ma D, Zhang K, Zhang M, Xin S, Liu X, Han Z, Shao Y, Liu S.