DRAVPR ID  DRAVPR0176

Name   Mj-sty

Sequence  SSFSPAAPLPPGTKHPCLPLSCPPCPDEECPTCEILPPCELCPEIHIGCDCPFHHSCLCDQPACPPCDFPFGSLINKGGYRG

Sequence Length  82

Source  Mainly gills and hemocytes; Marsupenaeus

UniProt ID None

Gene Not Available

Target Organism  WSSV

Activity 

• [Ref:26439413]WSSV:The transcription profiles demonstrated that in both of gills and hepatopancreas Mj-sty mRNA was down-regulated at the first several hours after infection of WSSV following with up-regulated to the highest level at 24 h–48 h, then considerably down-regulated at 48 h–72 h, and at the end of the experimental hours it returned to the half levels of the controls. Some penaeidins showed a similar expression profiles with Mj-sty against WSSV infection.

PDB ID  None

Predicted Structure Download  No predicted structure information available for the entry

Modification  No modifications on the sequence.

No comments found in the entry

Literature 1

Title   Identification and expression analysis of a novel stylicin antimicrobial peptide from Kuruma shrimp (Marsupenaeus japonicus)

Pubmed ID   26439413

Author   Liu, H. T., Wang, J., Mao, Y., Liu, M., Niu, S. F., Qiao, Y., Su, Y. Q., Wang, C. Z., & Zheng, Z. P. (2015).