To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPs021
Peptide Name hACE2(21-55)F32K-A36E
Sequence IEEQAKTFLDKⓀNHEⒺEDLFYQSSLASWNYNTNIT
Sequence Length 35
Original Sequence IEEQAKTFLDKNHEEEDLFYQSSLASWNYNTNIT
Source Synthetic Construct
Validation Experimentally Validated
Activity Information
Target Organism SARS-CoV-2
Assay Inhibition assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target membrane
Mechanism The stapled peptide inhibit the RBD-hACE2 complex formation, and hACE2 α1-helix-based peptidomimetics could potentially prevent SARS-CoV-2 from entering the human cells through hACE2 and thus inhibit subsequent viral replication.
Structure Information
Linear/Cyclic Cyclic
N-terminal Modification Free
C-terminal Modification Free
Special Amino Acid and Stapling Position Ⓚ (12) and Ⓔ (16) are corss-linked by lactam stapling.
Structure Description ①6-13% α-helical content in 10 mM PBS at pH 7.4 and 298 K.②11-52% α-helical content in 10 mM PBS at pH 7.4 with 30% TFE at 298 K.
Stereochemistry L
Literature Information
Literature 1
Title Targeting SARS-CoV-2 spike protein by stapled hACE2 peptides.
Pubmed ID 33651072
Reference Chem Commun (Camb). 2021 Apr 4;57(26):3283-3286.
Author Maas MN , Hintzen JCJ , Löffler PMG , Mecinović J .
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.