General Information
DRAVP ID DRAVPe00090
Peptide Name I33
Sequence QLLIRMIYKNILFYLVPGPGHGAEPERRNIKYL
Sequence Length 33
UniProt ID No entry found
Taxon ID None
Source Synthetic construct
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HIV
Assay Disintegration assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Integrase
Mechanism The peptide bound tightly to the integrase(IN) and inhibited both in vitro IN activities, containing 3′ end processing and strand transfer.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00090
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C183H291N49O44S
Absent amino acids CDSTW
Common amino acids L
Mass 3913.69
Pl 9.82
Basic residues 6
Acidic residues 2
Hydrophobic residues 12
Net charge 4
Boman Index -3510
Hydrophobicity -12.73
Aliphatic Index 118.18
Half Life
Extinction Coefficient cystines 4470
Absorbance 280nm 139.69
Polar residues 8
Literature Information
Literature 1
Title A novel short peptide is a specific inhibitor of the human immunodeficiency virus type 1 integrase.
Pubmed ID 12054767
Reference J Mol Biol. 2002 Apr 19;318(1):45-58.
Author de Soultrait VR, Caumont A, Parissi V, Morellet N, Ventura M, Lenoir C, Litvak S, Fournier M, Roques B.