General Information

General Information

DRAVP ID DRAVPe00090

Peptide Name I33

Sequence QLLIRMIYKNILFYLVPGPGHGAEPERRNIKYL

Sequence Length 33

UniProt ID No entry found

Source Synthetic construct

Activity Information

Target Organism HIV

Assay Disintegration assay

Activity

[Ref.12054767]HIV-1:Inhibition of 3′-end processing catalyzed by integrase(IC50=9 µM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

[Ref.12054767]P4 cells: Cell viability estimated by the MTT assay was decreased by about 5% at peptide concentrations higher than 100 μM.

Binding Target Integrase

Mechanism The peptide bound tightly to the integrase(IN) and inhibited both in vitro IN activities, containing 3′ end processing and strand transfer.

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00090

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C183H291N49O44S

Absent amino acids CDSTW

Common amino acids L

Mass 3913.69

Pl 9.82

Basic residues 6

Acidic residues 2

Hydrophobic residues 12

Net charge 4

Boman Index -3510

Hydrophobicity -12.73

Aliphatic Index 118.18

Half Life

Mammalian:0.8 hour
Yeast:10 min
E.coli:>10 hour

Extinction Coefficient cystines 4470

Absorbance 280nm 139.69

Polar residues 8

Literature Information

Literature 1

Title A novel short peptide is a specific inhibitor of the human immunodeficiency virus type 1 integrase.

Pubmed ID 12054767

Reference J Mol Biol. 2002 Apr 19;318(1):45-58.

Author de Soultrait VR, Caumont A, Parissi V, Morellet N, Ventura M, Lenoir C, Litvak S, Fournier M, Roques B.

DOI 10.1016/S0022-2836(02)00033-5