General Information


DRAVP ID  DRAVPe00090

Peptide Name   I33

Sequence  QLLIRMIYKNILFYLVPGPGHGAEPERRNIKYL

Sequence Length  33

UniProt ID  No entry found

Taxon ID  None

Source  Synthetic construct

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  HIV

Assay  Disintegration assay

Activity 

  • [Ref.12054767]HIV-1:Inhibition of 3′-end processing catalyzed by integrase(IC50=9 µM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.12054767]P4 cells: Cell viability estimated by the MTT assay was decreased by about 5% at peptide concentrations higher than 100 μM.

Binding Target  Integrase

Mechanism  The peptide bound tightly to the integrase(IN) and inhibited both in vitro IN activities, containing 3′ end processing and strand transfer.



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00090

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C183H291N49O44S

Absent amino acids  CDSTW

Common amino acids  L

Mass  3913.69

Pl  9.82

Basic residues  6

Acidic residues  2

Hydrophobic residues  12

Net charge  4

Boman Index  -3510

Hydrophobicity  -12.73

Aliphatic Index  118.18

Half Life 

  •     Mammalian:0.8 hour
  •     Yeast:10 min
  •     E.coli:>10 hour

Extinction Coefficient cystines  4470

Absorbance 280nm  139.69

Polar residues  8



Literature Information


Literature 1

Title   A novel short peptide is a specific inhibitor of the human immunodeficiency virus type 1 integrase.

Pubmed ID   12054767

Reference   J Mol Biol. 2002 Apr 19;318(1):45-58.

Author   de Soultrait VR, Caumont A, Parissi V, Morellet N, Ventura M, Lenoir C, Litvak S, Fournier M, Roques B. 

DOI   10.1016/S0022-2836(02)00033-5