General Information

General Information

DRAVP ID DRAVPe00111

Peptide Name C35

Sequence LSELDDRADALQAGASQFETSAAKLKRKYWWKN

Sequence Length 33

UniProt ID No entry found

Source Synthetic construct

Activity Information

Target Organism HIV

Assay Disintegration assay

Activity

[Ref.12054767]HIV-1:Inhibition of 3′-end processing catalyzed by integrase(IC50>200 µM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

[Ref.12054767]P4 cells: Cell viability estimated by the MTT assay was decreased by about 5% at peptide concentrations higher than 100 μM.

Binding Target Integrase

Mechanism Binding of both viral DNA and host chromosomal DNA are critical steps in IN-catalyzed reactions. The peptide interacted with the catalytic domain of IN interfering with the binding of the DNA substrate and inhibit the replication of virus.

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00111

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C169H262N48O52

Absent amino acids CHIMPV

Common amino acids A

Mass 3798.23

Pl 8.38

Basic residues 6

Acidic residues 5

Hydrophobic residues 13

Net charge 1

Boman Index -8333

Hydrophobicity -92.12

Aliphatic Index 65.45

Half Life

Mammalian:5.5 hour
Yeast:3 min
E.coli:2 min

Extinction Coefficient cystines 12490

Absorbance 280nm 390.31

Polar residues 7

Literature Information

Literature 1

Title A novel short peptide is a specific inhibitor of the human immunodeficiency virus type 1 integrase.

Pubmed ID 12054767

Reference J Mol Biol. 2002 Apr 19;318(1):45-58.

Author de Soultrait VR, Caumont A, Parissi V, Morellet N, Ventura M, Lenoir C, Litvak S, Fournier M, Roques B.

DOI 10.1016/S0022-2836(02)00033-5