General Information


DRAVP ID  DRAVPe00111

Peptide Name   C35

Sequence  LSELDDRADALQAGASQFETSAAKLKRKYWWKN

Sequence Length  33

UniProt ID  No entry found

Source  Synthetic construct



Activity Information


Target Organism  HIV

Assay  Disintegration assay

Activity 

  • [Ref.12054767]HIV-1:Inhibition of 3′-end processing catalyzed by integrase(IC50>200 µM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.12054767]P4 cells: Cell viability estimated by the MTT assay was decreased by about 5% at peptide concentrations higher than 100 μM.

Binding Target  Integrase

Mechanism  Binding of both viral DNA and host chromosomal DNA are critical steps in IN-catalyzed reactions. The peptide interacted with the catalytic domain of IN interfering with the binding of the DNA substrate and inhibit the replication of virus.



Structure Information


PDB ID  None

Predicted Structure Download  DRAVPe00111

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L



Physicochemical Information


Formula  C169H262N48O52

Absent amino acids  CHIMPV

Common amino acids  A

Mass  3798.23

Pl  8.38

Basic residues  6

Acidic residues  5

Hydrophobic residues  13

Net charge  1

Boman Index  -8333

Hydrophobicity  -92.12

Aliphatic Index  65.45

Half Life 

  •     Mammalian:5.5 hour
  •     Yeast:3 min
  •     E.coli:2 min

Extinction Coefficient cystines  12490

Absorbance 280nm  390.31

Polar residues  7



Literature Information


Literature 1

Title   A novel short peptide is a specific inhibitor of the human immunodeficiency virus type 1 integrase.

Pubmed ID   12054767

Reference   J Mol Biol. 2002 Apr 19;318(1):45-58.

Author   de Soultrait VR, Caumont A, Parissi V, Morellet N, Ventura M, Lenoir C, Litvak S, Fournier M, Roques B. 

DOI   10.1016/S0022-2836(02)00033-5