General Information
DRAVP ID DRAVPe00236
Peptide Name T-20S[138M]
Sequence YTSLIHSLIEEMQNQQEKNEQELLELDKWASLWNWF
Sequence Length 36
UniProt ID No entry found
Taxon ID None
Source Synthetic construct(derived from Enfuvirtide)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HIV
Assay MAGI assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target membrane
Mechanism The peptide prevents interactions between the C-HR and the N-terminal HR (N-HR) of gp41, thus interfering with conformational changes that are required for viral fusion.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00236
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C204H302N50O63S
Absent amino acids CGPRV
Common amino acids EL
Mass 4495
Pl 4.3
Basic residues 3
Acidic residues 7
Hydrophobic residues 13
Net charge -4
Boman Index -6684
Hydrophobicity -80
Aliphatic Index 89.44
Half Life
Extinction Coefficient cystines 17990
Absorbance 280nm 514
Polar residues 8
Literature Information
Literature 1
Title Design of peptide-based inhibitors for human immunodeficiency virus type 1 strains resistant to T-20.
Pubmed ID 19073606
Reference J Biol Chem. 2009 Feb 20;284(8):4914-20.
Author Izumi K, Kodama E, Shimura K, Sakagami Y, Watanabe K, Ito S, Watabe T, Terakawa Y, Nishikawa H, Sarafianos SG, Kitaura K, Oishi S, Fujii N, Matsuoka M.