General Information
DRAVP ID DRAVPe00240
Peptide Name T-20S[138Y]
Sequence YTSLIHSLIEEYQNQQEKNEQELLELDKWASLWNWF
Sequence Length 36
UniProt ID No entry found
Taxon ID None
Source Synthetic construct(derived from Enfuvirtide)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HIV
Assay MAGI assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target membrane
Mechanism The peptide prevents interactions between the C-HR and the N-terminal HR (N-HR) of gp41, thus interfering with conformational changes that are required for viral fusion.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00240
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C208H302N50O64
Absent amino acids CGMPRV
Common amino acids EL
Mass 4526.98
Pl 4.3
Basic residues 3
Acidic residues 7
Hydrophobic residues 13
Net charge -4
Boman Index -6933
Hydrophobicity -88.89
Aliphatic Index 89.44
Half Life
Extinction Coefficient cystines 19480
Absorbance 280nm 556.57
Polar residues 9
Literature Information
Literature 1
Title Design of peptide-based inhibitors for human immunodeficiency virus type 1 strains resistant to T-20.
Pubmed ID 19073606
Reference J Biol Chem. 2009 Feb 20;284(8):4914-20.
Author Izumi K, Kodama E, Shimura K, Sakagami Y, Watanabe K, Ito S, Watabe T, Terakawa Y, Nishikawa H, Sarafianos SG, Kitaura K, Oishi S, Fujii N, Matsuoka M.