DRAVP ID  DRAVPe00241

Peptide Name   T-20S[138W]

Sequence  YTSLIHSLIEEWQNQQEKNEQELLELDKWASLWNWF

Sequence Length  36

UniProt ID  No entry found

Taxon ID  None

Source  Synthetic construct(derived from Enfuvirtide)

Validation   Experimentally Validated

Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available

Target Organism  HIV

Assay  MAGI assay

Activity 

• [Ref.19073606]HIV-1WT:inhibition of virus replication in HeLa cells(EC50=29± 14 nM);
• HIV-1V38A:inhibition of virus replication in HeLa cells(EC50>1000 nM);
• HIV-1N43D:inhibition of virus replication in HeLa cells(EC50>1000 nM);
• HIV-1N43D/S138A:inhibition of virus replication in HeLa cells(EC50>1000 nM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  membrane

Mechanism  The peptide prevents interactions between the C-HR and the N-terminal HR (N-HR) of gp41, thus interfering with conformational changes that are required for viral fusion.

PDB ID  None

Predicted Structure Download  DRAVPe00241

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L

Literature 1

Title   Design of peptide-based inhibitors for human immunodeficiency virus type 1 strains resistant to T-20.

Pubmed ID   19073606

Reference   J Biol Chem. 2009 Feb 20;284(8):4914-20.

Author   Izumi K, Kodama E, Shimura K, Sakagami Y, Watanabe K, Ito S, Watabe T, Terakawa Y, Nishikawa H, Sarafianos SG, Kitaura K, Oishi S, Fujii N, Matsuoka M.

DOI   10.1074/jbc.M807169200