DRAVP ID  DRAVPe00249

Peptide Name   C34S[138A]

Sequence  WMEWDREINNYTSLIHSLIEEAQNQQEKNEQELL

Sequence Length  34

UniProt ID  No entry found

Source  Synthetic construct(derived from C34)

Target Organism  HIV

Assay  MAGI assay

Activity 

• [Ref.19073606]HIV-1 NL4-3:inhibition of virus replication in HeLa cells(EC50=2.0± 0.4 nM);
• HIV-1(NL4-3V38A):inhibition of virus replication in HeLa cells(EC50=1.7± 0.3 nM);
• HIV-1(NL4-3N43D):inhibition of virus replication in HeLa cells(EC50=2.0 ±0.6 nM);
• HIV-1(NL4-3N43D/S138A):inhibition of virus replication in HeLa cells(EC50=1.3 ±0.6 nM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

• No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target  membrane

Mechanism  The peptide prevents interactions between the C-HR and the N-terminal HR (N-HR) of gp41, thus interfering with conformational changes that are required for viral fusion.

PDB ID  None

Predicted Structure Download  DRAVPe00249

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Stereochemistry  L

Literature 1

Title   Design of peptide-based inhibitors for human immunodeficiency virus type 1 strains resistant to T-20.

Pubmed ID   19073606

Reference   J Biol Chem. 2009 Feb 20;284(8):4914-20.

Author   Izumi K, Kodama E, Shimura K, Sakagami Y, Watanabe K, Ito S, Watabe T, Terakawa Y, Nishikawa H, Sarafianos SG, Kitaura K, Oishi S, Fujii N, Matsuoka M.

DOI   10.1074/jbc.M807169200