General Information

General Information

DRAVP ID DRAVPe00252

Peptide Name C34S[138W]

Sequence WMEWDREINNYTSLIHSLIEEWQNQQEKNEQELL

Sequence Length 34

UniProt ID No entry found

Source Synthetic construct(derived from C34)

Activity Information

Target Organism HIV

Assay MAGI assay

Activity

[Ref.19073606]HIV-1 NL4-3:inhibition of virus replication in HeLa cells(EC50>1000 nM);
HIV-1(NL4-3V38A):inhibition of virus replication in HeLa cells(EC50>1000 nM);
HIV-1(NL4-3N43D):inhibition of virus replication in HeLa cells(EC50>1000 nM);
HIV-1(NL4-3N43D/S138A):inhibition of virus replication in HeLa cells(EC50>1000 nM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

No cytotoxicity information or data found in the reference(s) presented in this entry

Binding Target membrane

Mechanism The peptide prevents interactions between the C-HR and the N-terminal HR (N-HR) of gp41, thus interfering with conformational changes that are required for viral fusion.

Structure Information

PDB ID None

Predicted Structure Download DRAVPe00252

Linear/Cyclic Linear

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Stereochemistry L

Physicochemical Information

Formula C192H285N51O63S

Absent amino acids ACFGPV

Common amino acids E

Mass 4347.74

Pl 4.21

Basic residues 3

Acidic residues 8

Hydrophobic residues 10

Net charge -5

Boman Index -9597

Hydrophobicity -127.35

Aliphatic Index 80.29

Half Life

Mammalian:2.8 hour
Yeast:3 min
E.coli:2 min

Extinction Coefficient cystines 17990

Absorbance 280nm 545.15

Polar residues 8

Literature Information

Literature 1

Title Design of peptide-based inhibitors for human immunodeficiency virus type 1 strains resistant to T-20.

Pubmed ID 19073606

Reference J Biol Chem. 2009 Feb 20;284(8):4914-20.

Author Izumi K, Kodama E, Shimura K, Sakagami Y, Watanabe K, Ito S, Watabe T, Terakawa Y, Nishikawa H, Sarafianos SG, Kitaura K, Oishi S, Fujii N, Matsuoka M.

DOI 10.1074/jbc.M807169200