To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe00286
Peptide Name Cycloviolin-C (Plant defensin)
Sequence GIPCGESCVFIPCLTTVAGCSCKNKVCYRN
Sequence Length 30
UniProt ID P84639
Source Leonia cymosa (Sacha uba)
Activity Information
Target Organism HIV
Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00286
Linear/Cyclic Cyclic
N-terminal Modification Cyclization (N termini to C termini)
C-terminal Modification Cyclization (N termini to C termini)
Other Modification Disulfide bonds between Cys4 and Cys20, Cys8 and Cys22,Cys13 and Cys27.
Stereochemistry L
Physicochemical Information
Formula C133H217N37O40S6
Absent amino acids DHMQW
Common amino acids C
Mass 3166.77
Pl 8.33
Basic residues 3
Acidic residues 1
Hydrophobic residues 8
Net charge 2
Boman Index -1602
Hydrophobicity 45
Aliphatic Index 71.33
Half Life
Extinction Coefficient cystines 1865
Absorbance 280nm 64.31
Polar residues 16
Literature Information
Literature 1
Title Cyclotides as natural anti-HIV agents.
Pubmed ID 18008336
Reference Biopolymers. 2008;90(1):51-60.
Author Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.