General Information

General Information

DRAVP ID DRAVPe00292

Peptide Name Palicourein (Cyclotides; Plants)

Sequence GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN

Sequence Length 37

UniProt ID P84645

Source Palicourea condensata (Cappel)

Activity Information

Target Organism HIV

Assay

Activity

[Ref.18008336]HIV:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=100 nM).

Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity

[Ref.11430013] Cytotoxicity: human T-lymphoblastoid cell line (CEM-SS)(EC50=0.10 Μm, IC50=1.5 μM) .
[Ref.18008336]CEM-SS cells:IC50=1500 nM.

Binding Target Not found

Mechanism No machanism information found in the reference(s) presented in this entry

Structure Information

PDB ID 1R1F

Predicted Structure Download DRAVPe00292

Linear/Cyclic Cyclic

N-terminal Modification Cyclization (N termini to C termini)

C-terminal Modification Cyclization (N termini to C termini)

Other Modification Disulfide bonds between Cys1 and Cys19; Cys5 and Cys21; Cys11 and Cys28;hydrogen bonds between the oxygen atoms of the Glu3 carboxyl group and the backbone amides of residues Thr12, Thr13, and Ser14, and the side chain of Ser14.

Stereochemistry L

Physicochemical Information

Formula C159H256N48O56S6

Absent amino acids HMQW

Common amino acids C

Mass 3928.43

Pl 4.78

Basic residues 4

Acidic residues 5

Hydrophobic residues 8

Net charge -1

Boman Index -7498

Hydrophobicity -18.92

Aliphatic Index 52.7

Half Life

Mammalian:30 hour
Yeast:>20 hour
E.coli:>10 hour

Extinction Coefficient cystines 1865

Absorbance 280nm 51.81

Polar residues 18

Literature Information

Literature 1

Title Cyclotides as natural anti-HIV agents.

Pubmed ID 18008336

Reference Biopolymers. 2008;90(1):51-60.

Author Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.

DOI 10.1002/bip.20886