General Information


DRAVP ID  DRAVPe00292

Peptide Name   Palicourein (Cyclotides; Plants)

Sequence  GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN

Sequence Length  37

UniProt ID  P84645 

Taxon ID  None

Source  Palicourea condensata (Cappel)

Validation   Experimentally Validated



Origin Information


Gene Name/ID  Not Available

GenBank  Not Available

Amino Acid position  Not Available

Domain Accession ID  Not Available

Nucleotide sequence ID  Not Available

Molecular Type  Not Available

Chromosomal Position  Not Available



Activity Information


Target Organism  HIV

Assay 

Activity 

  • [Ref.18008336]HIV:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=100 nM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity 

  • [Ref.11430013] Cytotoxicity: human T-lymphoblastoid cell line (CEM-SS)(EC50=0.10 Μm, IC50=1.5 μM) .
  • [Ref.18008336]CEM-SS cells:IC50=1500 nM.

Binding Target  Not found

Mechanism  No machanism information found in the reference(s) presented in this entry



Structure Information


PDB ID  1R1F 

Predicted Structure Download  DRAVPe00292

Linear/Cyclic  Cyclic

N-terminal Modification  Cyclization (N termini to C termini)

C-terminal Modification  Cyclization (N termini to C termini)

Other Modification  Disulfide bonds between Cys1 and Cys19; Cys5 and Cys21; Cys11 and Cys28;hydrogen bonds between the oxygen atoms of the Glu3 carboxyl group and the backbone amides of residues Thr12, Thr13, and Ser14, and the side chain of Ser14.

Stereochemistry  L



Physicochemical Information


Formula  C159H256N48O56S6

Absent amino acids  HMQW

Common amino acids  C

Mass  3928.43

Pl  4.78

Basic residues  4

Acidic residues  5

Hydrophobic residues  8

Net charge  -1

Boman Index  -7498

Hydrophobicity  -18.92

Aliphatic Index  52.7

Half Life 

  •     Mammalian:30 hour
  •     Yeast:>20 hour
  •     E.coli:>10 hour

Extinction Coefficient cystines  1865

Absorbance 280nm  51.81

Polar residues  18



Literature Information


Literature 1

Title   Cyclotides as natural anti-HIV agents.

Pubmed ID   18008336

Reference   Biopolymers. 2008;90(1):51-60.

Author   Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.

DOI   10.1002/bip.20886