General Information
DRAVP ID DRAVPe00292
Peptide Name Palicourein (Cyclotides; Plants)
Sequence GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN
Sequence Length 37
UniProt ID P84645
Taxon ID None
Source Palicourea condensata (Cappel)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism HIV
Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
PDB ID 1R1F
Predicted Structure Download DRAVPe00292
Linear/Cyclic Cyclic
N-terminal Modification Cyclization (N termini to C termini)
C-terminal Modification Cyclization (N termini to C termini)
Other Modification Disulfide bonds between Cys1 and Cys19; Cys5 and Cys21; Cys11 and Cys28;hydrogen bonds between the oxygen atoms of the Glu3 carboxyl group and the backbone amides of residues Thr12, Thr13, and Ser14, and the side chain of Ser14.
Stereochemistry L
Physicochemical Information
Formula C159H256N48O56S6
Absent amino acids HMQW
Common amino acids C
Mass 3928.43
Pl 4.78
Basic residues 4
Acidic residues 5
Hydrophobic residues 8
Net charge -1
Boman Index -7498
Hydrophobicity -18.92
Aliphatic Index 52.7
Half Life
Extinction Coefficient cystines 1865
Absorbance 280nm 51.81
Polar residues 18
Literature Information
Literature 1
Title Cyclotides as natural anti-HIV agents.
Pubmed ID 18008336
Reference Biopolymers. 2008;90(1):51-60.
Author Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.