General Information
DRAVP ID DRAVPe00301
Peptide Name Neutrophil defensin 3 (Defensin, alpha 3; HNP-3, HP-3, HP3; Human, mammals, animals)
Sequence DCYCRIPACIAGERRYGTCIYQGRLWAFCC
Sequence Length 30
UniProt ID P59666 P11479 Q14125
Taxon ID None
Source Homo sapiens (Human)
Validation Experimentally Validated
Origin Information
Gene Name/ID Not Available
GenBank Not Available
Amino Acid position Not Available
Domain Accession ID Not Available
Nucleotide sequence ID Not Available
Molecular Type Not Available
Chromosomal Position Not Available
Activity Information
Target Organism SARS-CoV-2
Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target Not found
Mechanism No machanism information found in the reference(s) presented in this entry
Structure Information
Predicted Structure Download DRAVPe00301
Linear/Cyclic Cyclic
N-terminal Modification Free
C-terminal Modification Cyclization of a C-terminal Cys residue (forming a disulfide bond)
Other Modification Disulfide bonds between Cys2 and Cys30,Cys4 and Cys19,Cys9 and Cys29.
Stereochemistry L
Physicochemical Information
Formula C151H228N44O40S6
Absent amino acids HKMNSV
Common amino acids C
Mass 3492.1
Pl 8.33
Basic residues 4
Acidic residues 2
Hydrophobic residues 9
Net charge 2
Boman Index -4282
Hydrophobicity 12.33
Aliphatic Index 62
Half Life
Extinction Coefficient cystines 10345
Absorbance 280nm 356.72
Polar residues 13
Literature Information
Literature 1
Title Human Defensins Inhibit SARS-CoV-2 Infection by Blocking Viral Entry.
Pubmed ID 34206990
Reference Viruses. 2021 Jun 26;13(7):1246.
Author Xu C, Wang A, Marin M, Honnen W, Ramasamy S, Porter E, Subbian S, Pinter A, Melikyan GB, Lu W, Chang TL.