To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.
General Information
DRAVP ID DRAVPe00405
Peptide Name EK1C2
Sequence SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSG
Sequence Length 39
UniProt ID No entry found
Source Synthetic construct(derived from EK1)
Activity Information
Target Organism SARS-CoV-2
Assay
Activity
Hemolytic Activity No hemolysis information or data found in the reference(s) presented in this entry
Cytotoxicity No cytotoxicity information found in the reference(s) presented
Binding Target membrane
Mechanism The 6-HB structure formed by HR1 and HR2 regions in the S2 subunit of HCoVs plays a key role during the viral membrane fusion process,peptides derived from the HR2 regions can competitively inhibit viral 6-HB formation, thereby preventing viral fusion and entry into host cells.
Structure Information
PDB ID None
Predicted Structure Download DRAVPe00405
Linear/Cyclic Linear
N-terminal Modification Free
C-terminal Modification Chol
Other Modification None
Stereochemistry L
Physicochemical Information
Formula C203H328N46O68S
Absent amino acids CHPRW
Common amino acids EL
Mass 4533.16
Pl 4.36
Basic residues 5
Acidic residues 10
Hydrophobic residues 13
Net charge -5
Boman Index -6455
Hydrophobicity -44.1
Aliphatic Index 110
Half Life
Extinction Coefficient cystines 2980
Absorbance 280nm 78.42
Polar residues 9
Literature Information
Literature 1
Title Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion.
Pubmed ID 32231345
Reference Cell Res. 2020 Apr;30(4):343-355.
Author Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu L.
To the extent possible under law, the person who associated CC0 with this work has waived all copyright and related or neighboring rights to this work.