DRAVP ID  DRAVPe00408

Peptide Name   EK1C5

Sequence  SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG

Sequence Length  41

UniProt ID  No entry found

Source  Synthetic construct(derived from EK1)

Target Organism  SARS-CoV-2

Assay  pseudovirus inhibition assay

Activity 

• [Ref.32231345]SARS-CoV-2:ihibition of cell-cell fusion in 293T/ACE2 cells(IC50=3.1 nM),inhibition of Pseudovirus (PsV) infection in 293T/ACE2 cells(IC50=31.3 nM).

Hemolytic Activity  No hemolysis information or data found in the reference(s) presented in this entry

Cytotoxicity  No cytotoxicity information found in the reference(s) presented

Binding Target  membrane

Mechanism  The 6-HB structure formed by HR1 and HR2 regions in the S2 subunit of HCoVs plays a key role during the viral membrane fusion process,peptides derived from the HR2 regions can competitively inhibit viral 6-HB formation, thereby preventing viral fusion and entry into host cells.

PDB ID  None

Predicted Structure Download  No predicted structure available

Linear/Cyclic  Linear

N-terminal Modification  Free

C-terminal Modification  PEG8-Chol

Other Modification  None

Stereochemistry  L

Literature 1

Title   Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion.

Pubmed ID   32231345

Reference   Cell Res. 2020 Apr;30(4):343-355.

Author   Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu L.

DOI   10.1038/s41422-020-0305-x